Recombinant Human AKR1E2 protein

Specification
Description Recombinant protein from the full-length sequence of homo sapiens aldo-keto reductase family 1 member E2 (AKR1E2), transcript variant 1 (NM_001040177).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q96JD6
Entry Name AKCL2_HUMAN
Gene Names AKR1E2 AKR1CL2 AKRDC1
Alternative Gene Names AKR1CL2 AKRDC1
Alternative Protein Names 1,5-anhydro-D-fructose reductase (AF reductase) (EC 1.1.1.263) (Aldo-keto reductase family 1 member C-like protein 2) (Aldo-keto reductase family 1 member E2) (LoopADR) (Testis aldo-keto reductase) (htAKR) (Testis-specific protein) (hTSP)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 320
Molecular Weight(Da) 36589
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MGDIPAVGLSSWKASPGKVTEAVKEAIDAGYRHFDCAYFYHNEREVGAGIRCKIKEGAVRREDLFIATKLWCTCHKKSLVETACRKSLKALKLNYLDLYLIHWPMGFKPPHPEWIMSCSELSFCLSHPRVQDLPLDESNMVIPSDTDFLDTWEAMEDLVITGLVKNIGVSNFNHEQLERLLNKPGLRFKPLTNQIECHPYLTQKNLISFCQSRDVSVTAYRPLGGSCEGVDLIDNPVIKRIAKEHGKSPAQILIRFQIQRNVIVIPGSITPSHIKENIQVFDFELTQHDMDNILSLNRNLRLAMFPITKNHKDYPFHIEY
Background
Function FUNCTION: Catalyzes the NADPH-dependent reduction of 1,5-anhydro-D-fructose (AF) to 1,5-anhydro-D-glucitol (By similarity). Has low NADPH-dependent reductase activity towards 9,10-phenanthrenequinone (in vitro) (PubMed:12604216, PubMed:15118078). {ECO:0000250|UniProtKB:Q9DCT1, ECO:0000269|PubMed:12604216, ECO:0000269|PubMed:15118078}.
Pathway
Protein Families Aldo/keto reductase family
Tissue Specificity Specifically expressed in testis (PubMed:12604216, PubMed:15118078). Expressed in testicular germ cells and testis interstitial cells (PubMed:15118078). {ECO:0000269|PubMed:12604216, ECO:0000269|PubMed:15118078}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8372155

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human AKR1E2 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.