Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens akirin 2 (AKIRIN2) (NM_018064). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q53H80 |
| Entry Name | AKIR2_HUMAN |
| Gene Names | AKIRIN2 C6orf166 |
| Alternative Gene Names | C6orf166 |
| Alternative Protein Names | Akirin-2 |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 203 |
| Molecular Weight(Da) | 22496 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MACGATLKRTLDFDPLLSPASPKRRRCAPLSAPTSAAASPLSAAAATAASFSAAAASPQKYLRMEPSPFGDVSSRLTTEQILYNIKQEYKRMQKRRHLETSFQQTDPCCTSDAQPHAFLLSGPASPGTSSAASSPLKKEQPLFTLRQVGMICERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASYVS |
Background
| Function | FUNCTION: Required for the innate immune response. Downstream effector of the Toll-like receptor (TLR), TNF and IL-1 beta signaling pathways leading to the production of IL-6. Forms a complex with YWHAB that acts to repress transcription of DUSP1 (By similarity). {ECO:0000250}. |
| Pathway | |
| Protein Families | Akirin family |
| Tissue Specificity | Widely expressed with the highest expression in peripheral blood leukocytes. {ECO:0000269|PubMed:18066067}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
