Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens A-kinase anchoring protein 7 (AKAP7), transcript variant alpha (NM_004842). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | O43687 |
| Entry Name | AKA7A_HUMAN |
| Gene Names | AKAP7 AKAP15 AKAP18 |
| Alternative Gene Names | AKAP15 AKAP18 |
| Alternative Protein Names | A-kinase anchor protein 7 isoforms alpha and beta (AKAP-7 isoforms alpha and beta) (A-kinase anchor protein 18 kDa) (AKAP 18) (Protein kinase A-anchoring protein 7 isoforms alpha/beta) (PRKA7 isoforms alpha/beta) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 104 |
| Molecular Weight(Da) | 11465 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MGQLCCFPFSRDEGKISELESSSSAVLQRYSKDIPSWSSGEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK |
Background
| Function | FUNCTION: Targets the cAMP-dependent protein kinase (PKA) to the plasma membrane, and permits functional coupling to the L-type calcium channel. The membrane-associated form reduces epithelial sodium channel (ENaC) activity, whereas the free cytoplasmic form may negatively regulate ENaC channel feedback inhibition by intracellular sodium. {ECO:0000269|PubMed:10613906, ECO:0000269|PubMed:17244820, ECO:0000269|PubMed:9545239}. |
| Pathway | |
| Protein Families | |
| Tissue Specificity | Expressed in brain, heart, lung, pancreas and skeletal muscle. {ECO:0000269|PubMed:9545239}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |