Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | O00253 |
| Gene Names | AGRP |
| Alternative Names | Agouti related neuropeptide; Agouti Related Protein Homolog; Agouti-related protein; Agrp; AGRP_HUMAN; AGRT; ART; ASIP2 |
| Expression Region | Partial(83-132aa ) |
| Molecular Weight | 32.7 kDa |
| Protein Sequence | SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Plays a role in weight homeostasis. Involved in the control of feeding behavior through the central melanocortin syst. Acts as alpha melanocyte-stimulating hormone antagonist by inhibiting cAMP production mediated by stimulation of melanocortin receptors within the hypothalamus and adrenal gland. Has very low activity with MC5R . Is an inverse agonist for MC3R and MC4R being able to suppress their constitutive activity. It promotes MC3R and MC4R endocytosis in an arrestin-dependent manner.5 Publications |
| Involvement in Disease | Obesity (OBESITY) |
| Subcellular Location | Secreted, Golgi apparatus lumen |
| Protein Families | |
| Tissue Specificity | AGRP |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |