Specification
Organism | Homo sapiens (Human) |
Expression Host | E.coli |
Tag Info | N-terminal 6xHis-SUMO-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | O00253 |
Gene Names | AGRP |
Alternative Names | Agouti related neuropeptide; Agouti Related Protein Homolog; Agouti-related protein; Agrp; AGRP_HUMAN; AGRT; ART; ASIP2 |
Expression Region | Full Length of Mature Protein(21-132aa ) |
Molecular Weight | 28.5 kDa |
Protein Sequence | AQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Plays a role in weight homeostasis. Involved in the control of feeding behavior through the central melanocortin syst. Acts as alpha melanocyte-stimulating hormone antagonist by inhibiting cAMP production mediated by stimulation of melanocortin receptors within the hypothalamus and adrenal gland. Has very low activity with MC5R . Is an inverse agonist for MC3R and MC4R being able to suppress their constitutive activity. It promotes MC3R and MC4R endocytosis in an arrestin-dependent manner. |
Involvement in Disease | Obesity (OBESITY) |
Subcellular Location | Secreted, Golgi apparatus lumen |
Protein Families | |
Tissue Specificity | AGRP |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |