Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q9H0F7 |
| Gene Names | ARL6 |
| Alternative Names | Bardet-Biedl syndrome 3 protein |
| Expression Region | Full Length(1-186aa ) |
| Molecular Weight | 48 kDa |
| Protein Sequence | GLLDRLSVLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQNILPTIGFSIEKFKSSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTSVKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWLQDQIQTVKT |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Involved in membrane protein trafficking at the base of the ciliary organelle. Mediates recruitment onto plasma membrane of the BBSome complex which would constitute a coat complex required for sorting of specific membrane proteins to the primary cilia. Together with BBS1, is necessary for correct trafficking of PKD1 to primary cilia. Together with the BBSome complex and LTZL1, controls SMO ciliary trafficking and contributes to the sonic hedgehog (SHH) pathway regulation. May regulate cilia assembly and disassembly and subsequent ciliary signaling events such as the Wnt signaling cascade. Isoform 2 may be required for proper retinal function and organization |
| Involvement in Disease | Bardet-Biedl syndrome 3 (BBS3); Retinitis pigmentosa 55 (RP55) |
| Subcellular Location | Cell projection, cilium membrane, Peripheral membrane protein, Cytoplasmic side, Cytoplasm, cytoskeleton, cilium axoneme, Cytoplasm, cytoskeleton, cilium basal body |
| Protein Families | Small GTPase superfamily, Arf family |
| Tissue Specificity | ARL6 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |