Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P62330 |
| Gene Names | ARF6 |
| Alternative Names | ADP ribosylation factor 6 ; ADP ribosylation factor protein 6; ADP-ribosylation factor 6; ARF6; ARF6_HUMAN; DKFZp564M0264; Small GTP binding protein ; Small GTPase |
| Expression Region | Full Length(1-175aa ) |
| Molecular Weight | 36.1 kDa |
| Protein Sequence | MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | GTP-binding protein involved in protein trafficking that regulates endocytic recycling and cytoskeleton rodeling. Required for normal completion of mitotic cytokinesis. Plays a role in the reorganization of the actin cytoskeleton and the formation of stress fibers. May also modulate vesicle budding and uncoating within the Golgi apparatus. Involved in the regulation of dendritic spine development, contributing to the regulation of dendritic branching and filopodia extension. Functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase |
| Involvement in Disease | |
| Subcellular Location | Cytoplasm, cytosol, Cell membrane, Lipid-anchor, Endosome membrane, Lipid-anchor, Recycling endosome membrane, Lipid-anchor, Cell projection, filopodium membrane, Lipid-anchor, Cell projection, ruffle, Cleavage furrow, Midbody, Midbody ring, Golgi apparatus |
| Protein Families | Small GTPase superfamily, Arf family |
| Tissue Specificity | ARF6 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |