Specification
Organism | Homo sapiens (Human) |
Expression Host | E.coli |
Tag Info | N-terminal GST-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P18085 |
Gene Names | ARF2 |
Alternative Names | ADP ribosylation factor 2 ; ADP ribosylation factor 4; ADP-ribosylation factor 4; ARF2; ARF4; ARF4_HUMAN |
Expression Region | Full Length(1-180aa ) |
Molecular Weight | 47.5 kDa |
Protein Sequence | MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDRIRPLWKHYFQNTQGLIFVVDSNDRERIQEVADELQKMLLVDELRDAVLLLFANKQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus. |
Involvement in Disease | |
Subcellular Location | Golgi apparatus, Membrane, Lipid-anchor |
Protein Families | Small GTPase superfamily, Arf family |
Tissue Specificity | ARF2 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |