Recombinant Human Adiponectin receptor protein 1(ADIPOR1),partial

Specification
Organism Homo sapiens (Human)
Expression Host in vitro E.coli expression system
Tag Info N-terminal 6xHis-Flag-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q96A54
Gene Names ADIPOR1
Alternative Names Progestin and adipoQ receptor family member 1 (Progestin and adipoQ receptor family member I) (PAQR1) (TESBP1A)
Expression Region Partial(89-375aa )
Molecular Weight 34.8 kDa
Protein Sequence EGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Receptor for ADIPOQ, an essential hormone secreted by adipocytes that regulates glucose and lipid metabolism. Required for normal glucose and fat homeostasis and for maintaining a normal body weight. ADIPOQ-binding activates a signaling cascade that leads to increased AMPK activity, and ultimately to increased fatty acid oxidation, increased glucose uptake and decreased gluconeogenesis. Has high affinity for globular adiponectin and low affinity for full-length adiponectin.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity ADIPOR1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$1,821.00
In stock
SKU
EB-PCHU213797

Recombinant Human Adiponectin receptor protein 1(ADIPOR1),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Adiponectin receptor protein 1(ADIPOR1),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.