Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P07741 |
| Gene Names | APRT |
| Alternative Names | Adenine phosphoribosyltransferase; AMP; AMP diphosphorylase; AMP pyrophosphorylase; APRT; APT_HUMAN; DKFZp686D13177; MGC125856; MGC125857; MGC129961; Transphosphoribosidase |
| Expression Region | Full Length(1-180aa ) |
| Molecular Weight | 46.5 kDa |
| Protein Sequence | ADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis. |
| Involvement in Disease | Adenine phosphoribosyltransferase deficiency (APRTD) |
| Subcellular Location | Cytoplasm |
| Protein Families | Purine/pyrimidine phosphoribosyltransferase family |
| Tissue Specificity | APRT |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |