Recombinant Human ADAT2 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens adenosine deaminase tRNA specific 2 (ADAT2), transcript variant 1 (NM_182503).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q7Z6V5
Entry Name ADAT2_HUMAN
Gene Names ADAT2 DEADC1
Alternative Gene Names DEADC1
Alternative Protein Names tRNA-specific adenosine deaminase 2 (EC 3.5.4.33) (Deaminase domain-containing protein 1) (tRNA-specific adenosine-34 deaminase subunit ADAT2)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 191
Molecular Weight(Da) 21046
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MEAKAAPKPAASGACSVSAEETEKWMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCRQSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS
Background
Function FUNCTION: Probably participates in deamination of adenosine-34 to inosine in many tRNAs. {ECO:0000250}.
Pathway
Protein Families Cytidine and deoxycytidylate deaminase family, ADAT2 subfamily
Tissue Specificity
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8030935

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human ADAT2 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.