Specification
Organism | Homo sapiens (Human) |
Expression Host | E.coli |
Tag Info | N-terminal 6xHis-SUMO-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | Q96IU4 |
Gene Names | ABHD14B |
Alternative Names | ABHD14B; ABHEB_HUMAN; Abhydrolase domain containing 14B; Abhydrolase domain containing protein 14B; Abhydrolase domain-containing protein 14B; CCG1 interacting factor B; CCG1-interacting factor B; Cell cycle gene 1 interacting factor B; CIB; MGC15429; OTTHUMP00000212469 |
Expression Region | Full Length of Mature Protein(2-210aa ) |
Molecular Weight | 38.2 kDa |
Protein Sequence | AASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLQ |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | |
Involvement in Disease | |
Subcellular Location | Cytoplasm, Nucleus |
Protein Families | AB hydrolase superfamily, ABHD14 family |
Tissue Specificity | ABHD14B |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |