Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 2(ADAMTS2),partial

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID O95450
Gene Names ADAMTS2
Alternative Names Procollagen I N-proteinase (PC I-NP) (Procollagen I/II amino propeptide-processing enzyme) (Procollagen N-endopeptidase) (pNPI) (ADAM-TS 2) (ADAM-TS2) (ADAMTS-2) (PCINP) (PCPNI)
Expression Region Partial(254-492aa )
Molecular Weight 32.2 kDa
Protein Sequence RRRARRHAADDDYNIEVLLGVDDSVVQFHGKEHVQKYLLTLMNIVNEIYHDESLGAHINVVLVRIILLSYGKSMSLIEIGNPSQSLENVCRWAYLQQKPDTGHDEYHDHAIFLTRQDFGPSGMQGYAPVTGMCHPVRSCTLNHEDGFSSAFVVAHETGHVLGMEHDGQGNRCGDEVRLGSIMAPLVQAAFHRFHWSRCSQQELSRYLHSYDCLLDDPFAHDWPALPQLPGLHYSMNEQC
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Cleaves the propeptides of type I and II collagen prior to fibril assembly. Does not act on type III collagen. May also play a role in development that is independent of its role in collagen biosynthesis.
Involvement in Disease Ehlers-Danlos syndrome 7C (EDS7C)
Subcellular Location Secreted, extracellular space, extracellular matrix
Protein Families
Tissue Specificity ADAMTS2
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$275.00
In stock
SKU
EB-PE8HU1433

Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 2(ADAMTS2),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 2(ADAMTS2),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.