Recombinant Human 52KDA repressor of the inhibitor of the protein kinase(PRKRIR),partial

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID O43422
Gene Names PRKRIR
Alternative Names 58KDA interferon-induced protein kinase-interacting protein ;p58IPK-interacting proteinDeath-associated protein 4THAP domain-containing protein 0
Expression Region Partial(612-761aa )
Molecular Weight 33.6 kDa
Protein Sequence MGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFDIKHDLDLMVDTYIKLYTSKSELPTDNSETVENT
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Upstream regulator of interferon-induced serine/threonine protein kinase R (PKR). May block the PKR-inhibitory function of P58IPK, resulting in restoration of kinase activity and suppression of cell growth.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity PRKRIR
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PE9HU18844

Recombinant Human 52KDA repressor of the inhibitor of the protein kinase(PRKRIR),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human 52KDA repressor of the inhibitor of the protein kinase(PRKRIR),partial
Copyright © 2026-present Echo Bio. All rights reserved.