Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Yeast |
| Tag Info | C-terminal hFc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P28221 |
| Gene Names | HTR1D |
| Alternative Names | 5-HT-1D;5-HT1D;Serotonin 1D alpha receptor;5-HT-1D-alpha;Serotonin receptor 1D |
| Expression Region | Partial(1-38aa ) |
| Molecular Weight | 32.3 kDa |
| Protein Sequence | MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALK |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for ergot alkaloid derivatives, various anxiolytic and antidepressant drugs and other psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling inhibits adenylate cyclase activity. Regulates the release of 5-hydroxytryptamine in the brain, and thereby affects neural activity. May also play a role in regulating the release of other neurotransmitters. May play a role in vasoconstriction. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | |
| Tissue Specificity | HTR1D |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |