Specification
Organism | Homo sapiens (Human) |
Expression Host | E.coli |
Tag Info | N-terminal 6xHis-KSI-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P28221 |
Gene Names | HTR1D |
Alternative Names | 5-hydroxytryptamine receptor 1D(5-HT-1D)(5-HT1D)(Serotonin 1D alpha receptor)(5-HT-1D-alpha)(Serotonin receptor 1D) |
Expression Region | Partial(1-38aa ) |
Molecular Weight | 19.5 kDa |
Protein Sequence | MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALK |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for ergot alkaloid derivatives, various anxiolytic and antidepressant drugs and other psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling inhibits adenylate cyclase activity. Regulates the release of 5-hydroxytryptamine in the brain, and thereby affects neural activity. May also play a role in regulating the release of other neurotransmitters. May play a role in vasoconstriction. |
Involvement in Disease | |
Subcellular Location | |
Protein Families | |
Tissue Specificity | HTR1D |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |