Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P46783 |
| Gene Names | RPS10 |
| Alternative Names | 40S ribosomal protein S10; DBA9; MGC88819; OTTHUMP00000016229; OTTHUMP00000016230; RPS10; RS10_HUMAN; S10 |
| Expression Region | Partial(4-165aa ) |
| Molecular Weight | 45.5 kDa |
| Protein Sequence | PKKNRIAIYELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGYVKEQFAWRHFYWYLTNEGIQYLRDYLHLPPEIVPATLRRSRPETGRPRPKGLEGERPARLTRGEADRDTYRRSAVPPGADKKAEAGAGSATEFQFRGGFGRGRGQPPQ |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Component of the 40S ribosomal subunit. |
| Involvement in Disease | Diamond-Blackfan anemia 9 (DBA9) |
| Subcellular Location | Cytoplasm, Nucleus, nucleolus |
| Protein Families | Eukaryotic ribosomal protein eS10 family |
| Tissue Specificity | RPS10 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |