Recombinant Human 39S ribosomal protein L55, mitochondrial(MRPL55)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal GST-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q7Z7F7
Gene Names MRPL55
Alternative Names 39S ribosomal protein L55; 39S ribosomal protein L55; mitochondrial; AAVG5835; DKFZp686D1387; L55mt; L55nt; MGC61802; mitochondrial; Mitochondrial ribosomal protein L55; MRP L55; MRP-L55; MRPL55; PRO19675; RM55_HUMAN
Expression Region Full Length of Mature Protein(34-128aa )
Molecular Weight 38.6 kDa
Protein Sequence DSSRASLTRVHRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPIDLDTLSPEERRARLRKREAQLQSRKEYEQELSDDLHVERYRQFWTRTKK
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance
Involvement in Disease
Subcellular Location Mitochondrion
Protein Families Mitochondrion-specific ribosomal protein mL55 family
Tissue Specificity MRPL55
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PE2HU14997

Recombinant Human 39S ribosomal protein L55, mitochondrial(MRPL55)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human 39S ribosomal protein L55, mitochondrial(MRPL55)
Copyright © 2021-present Echo Biosystems. All rights reserved.