Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q99714 |
| Gene Names | HSD17B10 |
| Alternative Names | 17-beta-hydroxysteroid dehydrogenase 10 (EC:1.1.1.51) ;17-beta-HSD 103-hydroxy-2-methylbutyryl-CoA dehydrogenase (EC:1.1.1.178)3-hydroxyacyl-CoA dehydrogenase type IIEndoplasmic reticulum-associated amyloid beta-peptide-binding protein;Mitochondrial ribonuclease P protein 2 ;Mitochondrial RNase P protein 2Short chain dehydrogenase/reductase family 5C member 1Short-chain type dehydrogenase/reductase XH98G2Type II HADH |
| Expression Region | Full Length of Mature Protein(2-261aa ) |
| Molecular Weight | 42.8 kDa |
| Protein Sequence | AAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Functions in mitochondrial tRNA maturation. Part of mitochondrial ribonuclease P, an enzyme composed of MRPP1/TRMT10C, MRPP2/HSD17B10 and MRPP3/KIAA0391, which cleaves tRNA molecules in their 5'-ends. Catalyzes the beta-oxidation at position 17 of androgens and estrogens and has 3-alpha-hydroxysteroid dehydrogenase activity with androsterone. Catalyzes the third step in the beta-oxidation of fatty acids. Carries out oxidative conversions of 7-alpha-OH and 7-beta-OH bile acids. Also exhibits 20-beta-OH and 21-OH dehydrogenase activities with C21 steroids. By interacting with intracellular amyloid-beta, it may contribute to the neuronal dysfunction associated with Alzheimer disease (AD). |
| Involvement in Disease | HDS10 mitochondrial disease (HSD10MD); Mental retardation, X-linked 17 (MRX17) |
| Subcellular Location | Mitochondrion |
| Protein Families | Short-chain dehydrogenases/reductases (SDR) family |
| Tissue Specificity | HSD17B10 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |