Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P82650 |
| Gene Names | MRPS22 |
| Alternative Names | 28S ribosomal protein S22; C3orf5; COXPD5; GIBT; GK002; mitochondrial; Mitochondrial ribosomal protein S22; MRP-S22; MRPS22; RPM S22; RPMS22; RT22_HUMAN; S22mt |
| Expression Region | Full Length(1-360aa ) |
| Molecular Weight | 68.3 kDa |
| Protein Sequence | MAPLGTTVLLWSLLRSSPGVERVCFRARIQPWHGGLLQPLPCSFEMGLPRRRFSSEAAESGSPETKKPTFMDEEVQSILTKMTGLNLQKTFKPAIQELKPPTYKLMTQAQLEEATRQAVEAAKVRLKMPPVLEERVPINDVLAEDKILEGTETTKYVFTDISYSIPHRERFIVVREPSGTLRKASWEERDRMIQVYFPKEGRKILTPIIFKEENLRTMYSQDRHVDVLNLCFAQFEPDSTEYIKVHHKTYEDIDKRGKYDLLRSTRYFGGMVWYFVNNKKIDGLLIDQIQRDLIDDATNLVQLYHVLHPDGQSAQGAKDQAAEGINLIKVFAKTEAQKGAYIELTLQTYQEALSRHSAAS |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | |
| Involvement in Disease | Combined oxidative phosphorylation deficiency 5 (COXPD5) |
| Subcellular Location | Mitochondrion |
| Protein Families | Mitochondrion-specific ribosomal protein mS22 family |
| Tissue Specificity | MRPS22 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |