Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q9BPX1 |
| Gene Names | HSD17B14 |
| Alternative Names | 17-beta-hydroxysteroid dehydrogenase DHRS10Dehydrogenase/reductase SDR family member 10Retinal short-chain dehydrogenase/reductase retSDR3Short chain dehydrogenase/reductase family 47C member 1 |
| Expression Region | Full Length(1-270aa ) |
| Molecular Weight | 44.3 kDa |
| Protein Sequence | MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Has NAD-dependent 17-beta-hydroxysteroid dehydrogenase activity. Converts oestradiol to oestrone. The physiological substrate is not known. Acts on oestradiol and 5-androstene-3-beta,17-beta-diol (in vitro). |
| Involvement in Disease | |
| Subcellular Location | Cytoplasm |
| Protein Families | Short-chain dehydrogenases/reductases (SDR) family |
| Tissue Specificity | HSD17B14 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |