Specification
| Organism | Equus caballus (Horse) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P19857 |
| Gene Names | SAA1 |
| Alternative Names | Amyloid fibril protein AA |
| Expression Region | Full Length(1-110aa ) |
| Molecular Weight | 14.3 kDa |
| Protein Sequence | LLSFLGEAARGTWDMIRAYNDMREANYIGADKYFHARGNYDAAKRGPGGAWAAKVISDARENFQRFTDRFSFGGSGRGAEDSRADQAANEWGRSGKDPNHFRPHGLPDKY |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Major acute phase reactant. Apolipoprotein of the HDL complex. |
| Involvement in Disease | Reactive, secondary amyloidosis is characterized by the extracellular accumulation in various tissues of the SAA protein. These deposits are highly insoluble and resistant to proteolysis; they disrupt tissue structure and compromise function. |
| Subcellular Location | |
| Protein Families | SAA family |
| Tissue Specificity | SAA1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
