Recombinant Hirudo medicinalis Hirudin variant-1

Specification
Organism Hirudo medicinalis (Medicinal leech)
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P01050
Gene Names N/A
Alternative Names Hirudin variant-1; Hirudin-1; Hirudin-I; Lepirudin
Expression Region Full Length(1-65aa )
Molecular Weight 9 kDa
Protein Sequence VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Hirudin is a potent thrombin-specific protease inhibitor. It forms a stable non-covalent complex with alpha-thrombin, thereby abolishing its ability to cleave fibrinogen.
Involvement in Disease
Subcellular Location Secreted
Protein Families Protease inhibitor I14 (hirudin) family
Tissue Specificity N/A
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$392.00
In stock
SKU
EB-PYHSM365635

Recombinant Hirudo medicinalis Hirudin variant-1

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Hirudo medicinalis Hirudin variant-1
Copyright © 2021-present Echo Biosystems. All rights reserved.