Specification
| Organism | Hepatitis E virus genotype 1 (isolate Human/Pakistan/Sar-55) (HEV-1) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | O90299 |
| Gene Names | ORF3 |
| Alternative Names | ORF3; Protein ORF3; pORF3 |
| Expression Region | Full Length(1-114aa ) |
| Molecular Weight | 27.8 kDa |
| Protein Sequence | MGSRPWALGLFCCCSSCFCLCCSRHRPVSRLAAVVGGAAAVPAVVSGVTGLILSPSQSPIFIQPTPSPRMSPLRPGLDLVFANPSDHSAPLGATRPSAPPLPHVVDLPQLGPRR |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | May act as a viral regulatory protein involved in the modulation of mitogenic signaling pathways. May be involved in virion morphogenesis and viral pathogenesis. Expedites the processing and secretion of AMBP from the hepatocyte. |
| Involvement in Disease | |
| Subcellular Location | Host cytoplasm, host cytoskeleton |
| Protein Families | Hepevirus ORF3 protein family |
| Tissue Specificity | ORF3 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |