Specification
| Organism | Hepatitis E virus genotype 1 (isolate Human/Pakistan/Sar-55) (HEV-1) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P33424 |
| Gene Names | ORF1 |
| Alternative Names | ORF1; Non-structural polyprotein pORF1 [Includes: Methyltransferase; EC 2.1.1.-; EC 2.7.7.-); Putative papain-like cysteine protease; PLP; EC 3.4.22.-); NTPase/helicase; EC 3.6.4.-); RNA-directed RNA polymerase; RdRp; EC 2.7.7.48)] |
| Expression Region | Partial(60-240aa ) |
| Molecular Weight | 24.4 kDa |
| Protein Sequence | EVFWNHPIQRVIHNELELYCRARSGRCLEIGAHPRSINDNPNVVHRCFLRPAGRDVQRWYTAPTRGPAANCRRSALRGLPAADRTYCFDGFSGCNFPAETGIALYSLHDMSPSDVAEAMFRHGMTRLYAALHLPPEVLLPPGTYRTASYLLIHDGRRVVVTYEGDTSAGYNHDVSNLRSWI |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Methyltransferase displays a Cytoplasmic domain capping enzyme activity. This function is necessary since all viral RNAs are synthesized in the cytoplasm, and host capping enzymes are restricted to the nucleus. The enzymatic reaction involves a covalent link between 7-methyl-GMP and the methyltransferase, whereas eukaryotic capping enzymes form a covalent complex only with GMP. Methyltransferase catalyzes transfer of a methyl group from S-adenosylmethionine to GTP and GDP to yield m7GTP or m7GDP. GMP, GpppG, and GpppA were poor substrates for the methyltransferase. This enzyme also displays guanylyltransferase activity to form a covalent complex, methyltransferase-m7GMP, from which 7-methyl-GMP is transferred to the mRNA to create the cap structure. Cap analogs such as m7GTP, m7GDP, et2m7GMP, and m2et7GMP inhibit the methyltransferase reaction .RNA-directed RNA polymerase plays an essential role in the virus replication. Binds to the 3'-end of the genomic RNA, probably to initiate replication .. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | Hepevirus non-structural polyprotein family |
| Tissue Specificity | ORF1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
