Specification
| Organism | Hepatitis C virus genotype 1a (isolate 1) (HCV) |
| Expression Host | Mammalian cell |
| Tag Info | C-terminal 6xHis-Myc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P26664 |
| Gene Names | N/A |
| Alternative Names | Genome polyprotein [Cleaved into: Core protein p21; Capsid protein C; p21); Core protein p19; Envelope glycoprotein E1; gp32; gp35); Envelope glycoprotein E2; NS1; gp68; gp70); p7; Protease NS2-3; p23; EC 3.4.22.-); Serine protease NS3; EC 3.4.21.98; EC 3.6.1.15; EC 3.6.4.13; Hepacivirin; NS3P; p70); Non-structural protein 4A; NS4A; p8); Non-structural protein 4B; NS4B; p27); Non-structural protein 5A; NS5A; p56); RNA-directed RNA polymerase; EC 2.7.7.48; NS5B; p68)] |
| Expression Region | Partial(192-325aa ) |
| Molecular Weight | 18.7 kDa |
| Protein Sequence | YQVRNSTGLYHVTNDCPNSSIVYEAADAILHTPGCVPCVREGNASRCWVAMTPTVATRDGKLPATQLRRHIDLLVGSATLCSALYVGDLCGSVFLVGQLFTFSPRRHWTTQGCNCSIYPGHITGHRMAWDMMMN |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Capsid proteins VP1, VP2, and VP3 form a closed capsid enclosing the viral positive strand RNA genome. All these proteins contain a beta-sheet structure called beta-barrel jelly roll. Together they form an icosahedral capsid (T=3) composed of 60 copies of each VP1, VP2, and VP3, with a diameter of approximately 300 Angstroms. VP1 is situated at the 12 fivefold axes, whereas VP2 and VP3 are located at the quasi-sixfold axes. The capsid interacts with HAVCR1 to provide virion attachment to target cell. |
| Involvement in Disease | |
| Subcellular Location | Core protein p21: Host endoplasmic reticulum membrane, Single-pass membrane protein, Host mitochondrion membrane, Single-pass type I membrane protein, Host lipid droplet, Note=The C-terminal transmembrane domain of core protein p21 contains an ER signal leading the nascent polyprotein to the ER membrane, Only a minor proportion of core protein is present in the nucleus and an unknown proportion is secreted, SUBCELLULAR LOCATION: Core protein p19: Virion, Host cytoplasm, Host nucleus, Secreted, SUBCELLULAR LOCATION: Envelope glycoprotein E1: Virion membrane, Single-pass type I membrane protein, Host endoplasmic reticulum membrane, Single-pass type I membrane protein, Note=The C-terminal transmembrane domain acts as a signal sequence and forms a hairpin structure before cleavage by host signal peptidase, After cleavage, the membrane sequence is retained at the C-terminus of the protein, serving as ER membrane anchor, A reorientation of the second hydrophobic stretch occurs after cleavage producing a single reoriented transmembrane domain, These events explain the final topology of the protein, ER retention of E1 is leaky and, in overexpression conditions, only a small fraction reaches the plasma membrane, SUBCELLULAR LOCATION: Envelope glycoprotein E2: Virion membrane, Single-pass type I membrane protein, Host endoplasmic reticulum membrane, Single-pass type I membrane protein, Note=The C-terminal transmembrane domain acts as a signal sequence and forms a hairpin structure before cleavage by host signal peptidase, After cleavage, the membrane sequence is retained at the C-terminus of the protein, serving as ER membrane anchor, A reorientation of the second hydrophobic stretch occurs after cleavage producing a single reoriented transmembrane domain, These events explain the final topology of the protein, ER retention of E2 is leaky and, in overexpression conditions, only a small fraction reaches the plasma membrane, SUBCELLULAR LOCATION: p7: Host endoplasmic reticulum membrane, Multi-pass membrane protein, Host cell membrane, Note=The C-terminus of p7 membrane domain acts as a signal sequence, After cleavage by host signal peptidase, the membrane sequence is retained at the C-terminus of the protein, serving as ER membrane anchor, Only a fraction localizes to the plasma membrane, SUBCELLULAR LOCATION: Protease NS2-3: Host endoplasmic reticulum membrane, Multi-pass membrane protein, SUBCELLULAR LOCATION: Serine protease NS3: Host endoplasmic reticulum membrane, Peripheral membrane protein, Note=NS3 is associated to the ER membrane through its binding to NS4A, SUBCELLULAR LOCATION: Non-structural protein 4A: Host endoplasmic reticulum membrane, Single-pass type I membrane protein, Note=Host membrane insertion occurs after processing by the NS3 protease, SUBCELLULAR LOCATION: Non-structural protein 4B: Host endoplasmic reticulum membrane, Multi-pass membrane protein, SUBCELLULAR LOCATION: Non-structural protein 5A: Host endoplasmic reticulum membrane, Peripheral membrane protein, Host cytoplasm, host perinuclear region, Host mitochondrion, Note=Host membrane insertion occurs after processing by the NS3 protease, SUBCELLULAR LOCATION: RNA-directed RNA polymerase: Host endoplasmic reticulum membrane, Single-pass type I membrane protein |
| Protein Families | Hepacivirus polyprotein family |
| Tissue Specificity | N/A |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |