Recombinant Helicobacter pylori Vacuolating cytotoxin autotransporter(vacA),partial

Specification
Organism Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P55981
Gene Names vacA
Alternative Names vacA; HP_0887; Vacuolating cytotoxin autotransporter [Cleaved into: Vacuolating cytotoxin; Vacuolating cytotoxin translocator]
Expression Region Partial(37-245aa )
Molecular Weight 26.6 kDa
Protein Sequence TTVIIPAIVGGIATGAAVGTVSGLLGWGLKQAEEANKTPDKPDKVWRIQAGKGFNEFPNKEYDLYRSLLSSKIDGGWDWGNAATHYWVKGGQWNKLEVDMKDAVGTYNLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFTSYKDSADRTTRVDFNAKNILIDNFLEINNRVGSGAGRKASSTVLTLQASEGITSSKNAEISLYDGATLN
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Induces vacuolation of eukaryotic cells. Causes ulceration and gastric lesions.
Involvement in Disease
Subcellular Location Vacuolating cytotoxin autotransporter: Periplasm, SUBCELLULAR LOCATION: Vacuolating cytotoxin: Secreted, Cell surface, SUBCELLULAR LOCATION: Vacuolating cytotoxin translocator: Cell outer membrane, Multi-pass membrane protein
Protein Families
Tissue Specificity vacA
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PRN143899

Recombinant Helicobacter pylori Vacuolating cytotoxin autotransporter(vacA),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Helicobacter pylori Vacuolating cytotoxin autotransporter(vacA),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.