Specification
Organism | Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) |
Expression Host | Baculovirus |
Tag Info | N-terminal 10xHis-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P52093 |
Gene Names | ftnA |
Alternative Names | pfr |
Expression Region | Full Length(1-167aa ) |
Molecular Weight | 21.8 kDa |
Protein Sequence | MLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIVFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKGKDHATFNFLQWYVSEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRKS |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Iron-storage protein. |
Involvement in Disease | |
Subcellular Location | Cytoplasm |
Protein Families | Ferritin family, Prokaryotic subfamily |
Tissue Specificity | ftnA |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |