Specification
| Organism | Glycine max (Soybean) (Glycine hispida) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P54774 |
| Gene Names | CDC48 |
| Alternative Names | Valosin-containing protein homolog Short name: VCP |
| Expression Region | Partial(653-807aa ) |
| Molecular Weight | 33.5 kDa |
| Protein Sequence | DEDSRHQIFKACLRKSPIAKNVDLRALARHTQGFSGADITEICQRACKYAIRENIEKDIERERKSRENPEAMDEDTVDDEVAEIKAAHFEESMKFARRSVSDADIRKYQAFAQTLQQSRGFGSEFRFPESGDRTTTGSDPFAASAGGADEDDLYS |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Probably functions in cell division and growth processes. |
| Involvement in Disease | |
| Subcellular Location | Cell membrane, Peripheral membrane protein |
| Protein Families | AAA ATPase family |
| Tissue Specificity | CDC48 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |