Recombinant Gloydius blomhoffii Disintegrin halysin

Specification
Organism Gloydius blomhoffii (Mamushi) (Agkistrodon halys blomhoffi)
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P21858
Gene Names N/A
Alternative Names Platelet aggregation activation inhibitor
Expression Region Full Length(1-71aa )
Molecular Weight 9.5 kDa
Protein Sequence EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKKGTVCRIARGDDMDDYCNGISAGCPRNPF
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Inhibits fibrinogen interaction with platelets. Acts by binding to alpha-IIb/beta-3 (ITGA2B/ITGB3) on the platelet surface and inhibits aggregation induced by ADP, thrombin, platelet-activating factor and collagen.
Involvement in Disease
Subcellular Location Secreted
Protein Families Venom metalloproteinase (M12B) family, P-II subfamily, P-IIa sub-subfamily
Tissue Specificity N/A
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$392.00
In stock
SKU
EB-PYGGN322162

Recombinant Gloydius blomhoffii Disintegrin halysin

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Gloydius blomhoffii Disintegrin halysin
Copyright © 2021-present Echo Biosystems. All rights reserved.