Recombinant ESX-1 secretion-associated protein EspK(espK),partial

Specification
Organism Mycobacterium tuberculosis
Expression Host E.coli
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P9WJC1
Gene Names espK
Alternative Names
Expression Region Partial(21-114aa )
Molecular Weight 17.7 kDa
Protein Sequence VEADEDTFYDRAQEYSQVLQRVTDVLDTCRQQKGHVFEGGLWSGGAANAANGALGANINQLMTLQDYLATVITWHRHIAGLIEQAKSDIGNNVD
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance May act as a chaperone that facilitates EspB secretion through an interaction with EccCb1.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity espK
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEMVZ526786

Recombinant ESX-1 secretion-associated protein EspK(espK),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant ESX-1 secretion-associated protein EspK(espK),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.