Specification
Organism | Escherichia phage lambda (Bacteriophage lambda) |
Expression Host | E.coli |
Tag Info | N-terminal 6xHis-KSI-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P03712 |
Gene Names | D |
Alternative Names | Auxiliary protein D Gene product D Major capsid protein D |
Expression Region | Partial(1-56aa ) |
Molecular Weight | 21.2 kDa |
Protein Sequence | MTSKETFTHYQPQGNSDPAHTATAPGGLSAKAPAMTPLMLDTSSRKLVAWDGTTDG |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Stabilizes the expansion of the capsid head shell after genome packaging. The packaging of viral genome in the procapsid triggers a dramatic reconfiguration of the capsid shell, expanding from roughly 50nm to 60nm while the capsid thickness decreases. 415 capsid decoration protein molecules cooperatively bind the expanded capsid, thereby stabilizing the mature capsid shell. |
Involvement in Disease | |
Subcellular Location | |
Protein Families | |
Tissue Specificity | D |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |