Recombinant Escherichia coli Type 1 fimbrin D-mannose specific adhesin(fimH)

Specification
Organism Escherichia coli (strain K12)
Expression Host Yeast
Tag Info Tag-Free
Purity Greater than 85% by SDS-PAGE
Uniprot ID P08191
Gene Names fimH
Alternative Names fimH; b4320; JW4283Type 1 fimbrin D-mannose specific adhesin; Protein FimH
Expression Region Full Length of Mature Protein(22-300aa )
Molecular Weight 29.1 kDa
Protein Sequence FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Involved in regulation of length and mediation of adhesion of type 1 fimbriae (but not necessary for the production of fimbriae). Adhesin responsible for the binding to D-mannose. It is laterally positioned at intervals in the structure of the type 1 fimbriae. In order to integrate FimH in the fimbriae FimF and FimG are needed.
Involvement in Disease
Subcellular Location Fimbrium
Protein Families Fimbrial protein family
Tissue Specificity fimH
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$542.00
In stock
SKU
EB-PYVe13623616

Recombinant Escherichia coli Type 1 fimbrin D-mannose specific adhesin(fimH)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Escherichia coli Type 1 fimbrin D-mannose specific adhesin(fimH)
Copyright © 2021-present Echo Biosystems. All rights reserved.