Recombinant Escherichia coli Transposase insE for insertion sequence IS3A(insE1)

Specification
Organism Escherichia coli (strain K12)
Expression Host Mammalian cell
Tag Info C-terminal hFc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P0CF66
Gene Names insE1
Alternative Names insE1; b0298; JW5036; Transposase InsE for insertion sequence IS3A
Expression Region Full Length(1-99aa )
Molecular Weight 37.5 kDa
Protein Sequence MTKTVSTSKKPRKQHSPEFRSEALKLAERIGVTAAARELSLYESQLYNWRSKQQNQQTSSERELEMSTEIARLKRQLAERDEELAILQKAATYFAKRLK
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Involved in the transposition of the insertion sequence IS3.
Involvement in Disease
Subcellular Location
Protein Families Transposase 8 family
Tissue Specificity insE1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$450.00
In stock
SKU
EB-PMENV317302

Recombinant Escherichia coli Transposase insE for insertion sequence IS3A(insE1)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Escherichia coli Transposase insE for insertion sequence IS3A(insE1)
Copyright © 2026-present Echo Bio. All rights reserved.