Specification
Organism | Escherichia coli (strain K12 / DH10B) |
Expression Host | E.coli |
Tag Info | N-terminal 6xHis-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | B1XCM4 |
Gene Names | csrA |
Alternative Names | csrA; ECDH10B_2864; Translational regulator CsrA; Carbon storage regulator |
Expression Region | Full Length(1-61aa ) |
Molecular Weight | 10.9 kDa |
Protein Sequence | MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEKSQQSSY |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Affects glycogen biosynthesis, gluconeogenesis, cell size and surface properties. Regulates glycogen synthesis under both aerobic and anaerobic conditions. Seems to accelerate the degradation of glg gene transcripts, potentially through selective RNA binding. Acts to inhibit interaction between the LetD protein and the A subunit of DNA gyrase. Also required for motility and flagellum biosynthesis through the post-transcriptional activation of flhDC expression. This involves binding to and stabilization of the flhDC message by CsrA. |
Involvement in Disease | |
Subcellular Location | Cytoplasm |
Protein Families | CsrA/RsmA family |
Tissue Specificity | csrA |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |