Specification
| Organism | Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | B1IP41 |
| Gene Names | glpE |
| Alternative Names | glpE; EcolC_0289; Thiosulfate sulfurtransferase GlpE; EC 2.8.1.1 |
| Expression Region | Full Length(1-108aa ) |
| Molecular Weight | 16.1 kDa |
| Protein Sequence | MDQFECINVADAHQKLQEKEAVLVDIRDPQSFAMGHAVQAFHLTNDTLGAFMRDNDFDTPVMVMCYHGNSSKGAAQYLLQQGYDVVYSIDGGFEVWQRQFPAEVAYGA |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Catalyzes, although with low efficiency, the sulfur transfer reaction from thiosulfate to cyanide. |
| Involvement in Disease | |
| Subcellular Location | Cytoplasm |
| Protein Families | GlpE family |
| Tissue Specificity | glpE |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |