Specification
| Organism | Escherichia coli (strain K12) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P0A7H6 |
| Gene Names | recR |
| Alternative Names | recR; b0472; JW0461; Recombination protein RecR |
| Expression Region | Full Length(1-201aa ) |
| Molecular Weight | 38 kDa |
| Protein Sequence | MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGPDDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQYDVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIRF |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | May play a role in DNA repair. It ses to be involved in an RecBC-independent recombinational process of DNA repair. It may act with RecF and RecO. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | RecR family |
| Tissue Specificity | recR |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |