Specification
| Organism | Escherichia coli (strain K12) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-Flag-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P58042 |
| Gene Names | rzoR |
| Alternative Names | Outer membrane lipoprotein Rz1 from lambdoid prophage Rac (Spanin from lambdoid prophage Rac, outer membrane subunit) (o-spanin) |
| Expression Region | Full Length of Mature Protein(20-61aa ) |
| Molecular Weight | 11.5 kDa |
| Protein Sequence | CTSKQSVSQCVKPPPPPAWIMQPPPDWQTPLNGIISPSGNDW |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Component of the spanin complex that disrupts the outer membrane and causes cell lysis during virus exit. The spanin complex conducts the final step in cell lysis by disrupting the outer membrane after holin and endolysin action have permeabilized the inner membrane and degraded the host peptidoglycans. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | |
| Tissue Specificity | rzoR |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |