Recombinant Escherichia coli Probable diguanylate cyclase DgcQ(dgcQ),partial

Specification
Organism Escherichia coli (strain K12)
Expression Host E.coli
Tag Info N-terminal GST-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P76330
Gene Names dgcQ
Alternative Names Cellulose synthesis regulatory protein
Expression Region Partial(381-564aa )
Molecular Weight 47.5 kDa
Protein Sequence RRMVSNMYVLQSSLQWQAWHDTLTRLYNRGALFEKARPLAKLCQTHQHPFSVIQVDLDHFKAINDRFGHQAGDRVLSHAAGLISSSLRAQDVAGRVGGEEFCVILPGASLTEAAEVAERIRLKLNEKEMLIAKSTTIRISASLGVSSSEETGDYDFEQLQSLADRRLYLAKQAGRNRVFASDNA
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Involved in the regulation of cellulose production. Cyclic-di-GMP is a second messenger which controls cell surface-associated traits in bacteria.
Involvement in Disease
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families
Tissue Specificity dgcQ
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PR4Ba85369

Recombinant Escherichia coli Probable diguanylate cyclase DgcQ(dgcQ),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Escherichia coli Probable diguanylate cyclase DgcQ(dgcQ),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.