Recombinant Escherichia coli Penicillin-binding protein 1A(mrcA),partial,Biotinylated

Specification
Organism Escherichia coli (strain K12)
Expression Host E.coli
Protein Tag N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
Purity Greater than 90% as determined by SDS-PAGE.
Endotoxin Level Not test.
Biological Activity
Uniprot ID P02918
Gene Names mrcA
Alternative Names Short name: PBP-1a Short name: PBP1a Including the following 2 domains: Penicillin-insensitive transglycosylase Alternative name(s): Peptidoglycan TGase Penicillin-sensitive transpeptidase Alternative name(s): DD-transpeptidase
Expression Region 229-529aa
Product Form Liquid or Lyophilized powder
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.461 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-575℃.
Protein Length Partial
Molecular Weight 81.2 kDa
Protein Sequence MLDEGYITQQQFDQTRTEAINANYHAPEIAFSAPYLSEMVRQEMYNRYGESAYEDGYRIYTTITRKVQQAAQQAVRNNVLDYDMRHGYRGPANVLWKVGESAWDNNKITDTLKALPTYGPLLPAAVTSANPQQATAMLADGSTVALSMEGVRWARPYRSDTQQGPTPRKVTDVLQTGQQIWVRQVGDAWWLAQVPEVNSALVSINPQNGAVMALVGGFDFNQSKFNRATQALRQVGSNIKPFLYTAAMDKGLTLASMLNDVPISRWDASAGSDWQPKNSPPQYAGPIRLRQGLGQSKNVVM
Background
Research Areas Microbiology
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$540.00
In stock
SKU
EB-N231496

Protein expressed from mulitple host is available with various size. Please inquiry us if you need any customized needs.

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Escherichia coli Penicillin-binding protein 1A(mrcA),partial,Biotinylated
Copyright © 2021-present Echo Biosystems. All rights reserved.