Recombinant Escherichia coli O9:H4 Outer-membrane lipoprotein carrier protein(lolA)

Specification
Organism Escherichia coli O9:H4 (strain HS)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID A7ZYJ5
Gene Names lolA
Alternative Names lolA; EcHS_A0996; Outer-membrane lipoprotein carrier protein
Expression Region Full Length of Mature Protein(22-203aa )
Molecular Weight 24.3 kDa
Protein Sequence DAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDDQRK
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Participates in the translocation of lipoproteins from the inner mbrane to the outer mbrane. Only forms a complex with a lipoprotein if the residue after the N-terminal Cys is not an aspartate (The Asp acts as a targeting signal to indicate that the lipoprotein should stay in the inner mbrane).
Involvement in Disease
Subcellular Location Periplasm
Protein Families LolA family
Tissue Specificity lolA
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEEJF419700

Recombinant Escherichia coli O9:H4 Outer-membrane lipoprotein carrier protein(lolA)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Escherichia coli O9:H4 Outer-membrane lipoprotein carrier protein(lolA)
Copyright © 2021-present Echo Biosystems. All rights reserved.