Specification
Organism | Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) |
Expression Host | E.coli |
Protein Tag | N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged |
Purity | Greater than 90% as determined by SDS-PAGE. |
Endotoxin Level | |
Biological Activity | |
Uniprot ID | P0A8W9 |
Gene Names | yfbU |
Alternative Names | |
Expression Region | 1-164aa |
Product Form | Liquid or Lyophilized powder |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.1552 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-1674℃. |
Protein Length | Full Length |
Molecular Weight | 67.3 kDa |
Protein Sequence | MEMTNAQRLILSNQYKMMTMLDPANAERYRRLQTIIERGYGLQMRELDREFGELKEETCRTIIDIMEMYHALHVSWSNLQDQQSIDERRVTFLGFDAATEARYLGYVRFMVNVEGRYTHFDAGTHGFNAQTPMWEKYQRMLNVWHACPRQYHLSANEINQIINA |
Background
Research Areas | Others |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |