Recombinant Escherichia coli O6:H1 Lipopolysaccharide export system protein LptC(lptC)

Specification
Organism Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P0ADW0
Gene Names lptC
Alternative Names lptC; c3959; Lipopolysaccharide export system protein LptC
Expression Region Full Length(1-191aa )
Molecular Weight 23.7 kDa
Protein Sequence MSKARRWVIIVLSLAVLVMIGINMAEKDDTAQVVVNNNDPTYKSEHTDTLVYNPEGALSYRLIAQHVEYYSDQAVSWFTQPVLTTFDKDKIPTWSVKADKAKLTNDRMLYLYGHVEVNALVPDSQLRRITTDNAQINLVTQDVTSEDLVTLYGTTFNSSGLKMRGNLRSKNAELIEKVRTSYEIQNKQTQP
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Involved in the assbly of lipopolysaccharide (LPS). Required for the translocation of LPS from the inner mbrane to the outer mbrane. Facilitates the transfer of LPS from the inner mbrane to the periplasmic protein LptA. Could be a docking site for LptA.
Involvement in Disease
Subcellular Location Cell inner membrane, Single-pass membrane protein
Protein Families LptC family
Tissue Specificity lptC
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$392.00
In stock
SKU
EB-PYEGX360140

Recombinant Escherichia coli O6:H1 Lipopolysaccharide export system protein LptC(lptC)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Escherichia coli O6:H1 Lipopolysaccharide export system protein LptC(lptC)
Copyright © 2021-present Echo Biosystems. All rights reserved.