Specification
Organism | Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) |
Expression Host | E.coli |
Tag Info | N-terminal 6xHis-SUMO-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P0ADW0 |
Gene Names | lptC |
Alternative Names | lptC; c3959; Lipopolysaccharide export system protein LptC |
Expression Region | Full Length(1-191aa ) |
Molecular Weight | 37.7 kDa |
Protein Sequence | MSKARRWVIIVLSLAVLVMIGINMAEKDDTAQVVVNNNDPTYKSEHTDTLVYNPEGALSYRLIAQHVEYYSDQAVSWFTQPVLTTFDKDKIPTWSVKADKAKLTNDRMLYLYGHVEVNALVPDSQLRRITTDNAQINLVTQDVTSEDLVTLYGTTFNSSGLKMRGNLRSKNAELIEKVRTSYEIQNKQTQP |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Involved in the assbly of lipopolysaccharide (LPS). Required for the translocation of LPS from the inner mbrane to the outer mbrane. Facilitates the transfer of LPS from the inner mbrane to the periplasmic protein LptA. Could be a docking site for LptA. |
Involvement in Disease | |
Subcellular Location | Cell inner membrane, Single-pass membrane protein |
Protein Families | LptC family |
Tissue Specificity | lptC |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |