Specification
| Organism | Escherichia coli O157:H7 (strain TW14359 / EHEC) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | C6UYL8 |
| Gene Names | tir |
| Alternative Names | Secreted effector protein Tir |
| Expression Region | Extracellular Domain(252-362aa ) |
| Molecular Weight | 27.8 kDa |
| Protein Sequence | QALALTPEPDSPTTTDPDAAASATETATRDQLTKEAFQNPDNQKVNIDELGNAIPSGVLKDDVVANIEEQAKAAGEEAKQQAIENNAQAQKKYDEQQAKRQEELKVSSGAG |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Multifunctional protein that is required for efficient pedestal formation in host epithelial cells during infection. The Extracellular domain region acts as a receptor for bacterial intimin, allowing the bacterium to attach tightly to the host-cell surface. Simultaneously, the intracellular region initiates a signaling cascade in the host cell, which leads to actin polymerization and formation of actin pedestals at the sites of bacterial adhesion |
| Involvement in Disease | |
| Subcellular Location | Secreted, Host cell membrane, Multi-pass membrane protein |
| Protein Families | Tir receptor family |
| Tissue Specificity | tir |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |