Specification
    
        | Uniprot ID | Q93U24 | 
| Gene Names | csgA | 
| Alternative Names | |
| Organism | Escherichia coli O157:H7 | 
| Expression Host | Yeast | 
| Tag Info | C-terminal 6xHis-tagged | 
| Molecular Weight | 14.6 kDa | 
| Expression Region | Full Length of Mature Protein(21-152aa ) | 
| Expression Region | C-terminal 6xHis-tagged(Full Length of Mature Protein ) | 
| Purity | Greater than 85% as determined by SDS-PAGE. | 
| Endotoxin | Not test. | 
| Form | Liquid or Lyophilized powder | 
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. | 
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. | 
| Storage | Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. | 
| Protein Sequence | GVVPQYGGGGGNHGGGGNNSGPNSELNIYQYGGGNSALALQADARNSDLTITQHGGGNGADVGQGSDDSSIDLTQRGFGNSATLDQWNGKDSHMTVKQFGGGNGAAVDQTASNSTVNVTQVGFGNNATAHQY | 
        Background
    
        | Research Areas | Others | 
        QC Data
    
        | Note | Please contact us for QC Data | 
| Product Image (Reference Only) | ![]()  |  
