Specification
| Organism | Escherichia coli O157:H7 |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-B2M-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P0A743 |
| Gene Names | mscL |
| Alternative Names | mscL; Z4661; ECs4156; Large-conductance mechanosensitive channel |
| Expression Region | Full Length(1-136aa ) |
| Molecular Weight | 29 kDa |
| Protein Sequence | MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVTLRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAAPAPTKEEVLLTEIRDLLKEQNNRS |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Channel that opens in response to stretch forces in the membrane lipid bilayer. May participate in the regulation of osmotic pressure changes within the cell (By similarity). |
| Involvement in Disease | |
| Subcellular Location | Cell inner membrane, Multi-pass membrane protein |
| Protein Families | MscL family |
| Tissue Specificity | mscL |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |