Recombinant Escherichia coli O157:H7 7-alpha-hydroxysteroid dehydrogenase(hdhA)

Specification
Organism Escherichia coli O157:H7
Expression Host E.coli
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P0AET9
Gene Names hdhA
Alternative Names 7-alpha-HSDH
Expression Region Full Length(1-255aa )
Molecular Weight 34.2 kDa
Protein Sequence MFNSDNLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPFDMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGVQELN
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Catalyzes the oxidation of the 7-alpha-hydroxy group of primary bile acids such as cholate
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity hdhA
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEEOD365322

Recombinant Escherichia coli O157:H7 7-alpha-hydroxysteroid dehydrogenase(hdhA)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Escherichia coli O157:H7 7-alpha-hydroxysteroid dehydrogenase(hdhA)
Copyright © 2021-present Echo Biosystems. All rights reserved.