Specification
| Organism | Escherichia coli (strain K12) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-KSI-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P69776 |
| Gene Names | lpp |
| Alternative Names | Braun lipoprotein (Murein-lipoprotein) (mlpA) (mulI) |
| Expression Region | Full Length of Mature Protein(21-78aa ) |
| Molecular Weight | 21.8 kDa |
| Protein Sequence | CSSNAKIDQLSSDVQTLNAKVDQLSNDVNAMRSDVQAAKDDAARANQRLDNMATKYRK |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Interacts with the peptidoglycan both covalently and noncovalently. This interaction contributes to the maintenance of the structural and functional integrity of the cell envelope. |
| Involvement in Disease | |
| Subcellular Location | Cell outer membrane, Lipid-anchor, Cell outer membrane, Peptidoglycan-anchor |
| Protein Families | Lpp family |
| Tissue Specificity | lpp |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |