Recombinant Escherichia coli Lipopolysaccharide export system protein lptA(lptA)

Specification
Organism Escherichia coli (strain K12)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P0ADV1
Gene Names lptA
Alternative Names lptA; yhbN; b3200; JW3167; Lipopolysaccharide export system protein LptA
Expression Region Full Length of Mature Protein(28-185aa )
Molecular Weight 33.3 kDa
Protein Sequence VTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPSQLQDKNNKGQTPAQKKGN
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Involved in the assbly of lipopolysaccharide (LPS). Required for the translocation of LPS from the inner mbrane to the outer mbrane. May form a bridge between the inner mbrane and the outer mbrane, via interactions with LptC and LptD, thereby facilitating LPS transfer across the periplasm.
Involvement in Disease
Subcellular Location Periplasm
Protein Families LptA family
Tissue Specificity lptA
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEENV360135

Recombinant Escherichia coli Lipopolysaccharide export system protein lptA(lptA)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Escherichia coli Lipopolysaccharide export system protein lptA(lptA)
Copyright © 2021-present Echo Biosystems. All rights reserved.